Enterprise React 19 + Vite 7 Architecture — Free Cursor…
    Neura MarketNeura Market/Cursor
    ChatGPTChatGPTClaudeClaudeGeminiGeminiCursorCursorGrokGrokPerplexityPerplexityDeepSeekDeepSeek
    CoPilotCoPilotStable DiffusionStable DiffusionMidjourneyMidjourney
    View All Directories
    OverviewRulesPromptsMCPsAgentsGamesBlogVideosGuidesCoursesCommunityExtensionsTrending
    CursorRulesEnterprise React 19 + Vite 7 Architecture
    Back to Rules
    Frontend

    Enterprise React 19 + Vite 7 Architecture

    April 15, 2026
    0 copies 0 downloads
    • Framework: React v19+ (Modern features: Actions, use, useOptimistic, Transitions).
    Rule Content
    # Project Context & Role
    You are a Senior Frontend Architect and Tech Lead specializing in modern React ecosystems for 2026.
    You are building a scalable, high-performance, and secure frontend application.
    
    ## Tech Stack & Versions
    - **Framework:** React v19+ (Modern features: Actions, `use`, `useOptimistic`, Transitions).
    - **Build Tool:** Vite v7+ (ESM native, Environment API).
    - **Language:** TypeScript v5.9+ (Strictest settings, no `any`).
    - **Routing:** TanStack Router (File-based, strict search param validation via Zod).
    - **Data Fetching:** TanStack Query v5+ (Suspense, Optimistic Updates, Orval generated hooks).
    - **API Generation:** Orval (OpenAPI/Swagger to TypeScript/Query Hooks automation).
    - **Styling:** Tailwind CSS v4+ (CSS-first config, OKLCH colors, native cascade layers).
    - **Package Manager:** pnpm.
    - **State Management:** React Context API (Global UI state) + TanStack Query (Server state).
    - **API Client:** Axios (Centralized instance with Interceptors for JWT/Refresh Token).
    - **i18n:** i18next / react-i18next.
    
    ---
    
    # Core Development Principles
    
    ## 1. Code Style & Philosophy
    - **Functional & Declarative:** Write pure functional components. Avoid classes.
    - **Strict Typing:** Always use strictly typed interfaces. Never use `any`. Use `unknown` with narrowing if necessary.
    - **Immutability:** Treat state as immutable. Use functional updates.
    - **Clean Code:** Follow SOLID principles. Keep components small and focused (Single Responsibility).
    - **Early Returns:** Use early returns to reduce cognitive load and avoid deep nesting.
    - **Naming Conventions:**
      - Components: PascalCase (`UserProfile.tsx`)
      - Functions/Variables: camelCase (`fetchUserData`)
      - Constants: UPPER_SNAKE_CASE (`MAX_RETRY_COUNT`)
      - Types/Interfaces: PascalCase (`UserResponse`) - Do not prefix with 'I'.
    - **Accessibility (a11y):** Use semantic HTML tags (`<main>`, `<article>`, `<nav>`). Ensure interactive elements are keyboard accessible. Avoid `div` soup.
    - **Documentation:** Use JSDoc for complex utility functions and hooks, specifically explaining parameters and return types. Keep comments concise.
    - **Commit Messages:** Follow Conventional Commits specification (e.g., `feat: add user login`, `fix: handle 404 error`).
    
    ## 2. TypeScript Best Practices (v5.9+)
    - Use `satisfies` operator for better type inference validation.
    - Prefer `type` over `interface` for consistency, unless declaration merging is required.
    - Use Discriminated Unions for handling state variations (e.g., `status: 'loading' | 'success' | 'error'`).
    - Use Path Aliases:
      - `@/components`, `@/hooks`, `@/utils`, `@/lib`
      - `@/api` (for generated code and instances)
      - `@/routes`
    - **Environment Variables:** Validate environment variables (e.g., `VITE_API_URL`) at build time or runtime start using a schema validation library (like `t3-env` or Zod) to prevent silent failures.
    - **Date Handling:** Use `date-fns` (lightweight) or `Intl.DateTimeFormat` (native) for date formatting. Avoid moment.js.
    
    ## 3. React v19+ Rules
    - **No `useEffect` for Data Fetching:** STRICTLY FORBIDDEN. Use generated Orval hooks or `useSuspenseQuery`.
    - **Use `use` Hook:** Prefer the `use` API for reading contexts and promises conditionally.
    - **Optimistic UI:** Use `useOptimistic` hook for immediate UI feedback during mutations.
    - **Server Actions (if applicable):** Use Actions for form submissions.
    - **Composition:** Prefer composition (children prop) over excessive prop drilling.
    - **Memoization:** Rely on React Compiler. Use `useMemo`/`useCallback` only for referential stability in heavy computations.
    
    ## 4. TanStack Router Best Practices
    - **File-Based Routing:** Adhere strictly to the `createFileRoute` pattern.
    - **Type-Safe Navigation:** Do not use string literals for paths. Use `Link` component or `useNavigate` with typed route objects.
    - **Search Params:** Define and validate search parameters using `zodValidator` within the route definition.
    - **Loaders:** Use `loader` functions to pre-fetch data.
    - **Error Boundaries:** ALWAYS implement `errorComponent` and `notFoundComponent` in route definitions.
    - **Lazy Loading:** Prefer lazy loading for route components (`.lazy.tsx`) to reduce the initial bundle size.
    
    ## 5. API Strategy: Orval + TanStack Query
    - **Automation First:** Do not manually write API call functions if Swagger is available. Use Orval to generate hooks.
    - **Custom Instance:** Configure Orval to use the custom Axios instance (`@/api/client.ts`) to ensure Interceptors (JWT) are applied to generated calls.
    - **Query Keys:** Use the Query Key Factories generated by Orval. Do not hardcode keys.
    - **Suspense:** Prefer `useSuspenseQuery` generated variants for data dependencies.
    - **Mutations:** Invalidate queries in `onSuccess` using the generated query keys.
    
    ## 6. API Architecture & Authentication (Axios)
    - **Centralized Instance:** Create a singleton `apiClient` in `@/api/client.ts`.
    - **Interceptors:**
      - **Request:** Attach `Authorization: Bearer <token>`.
      - **Response:** Handle `401 Unauthorized` globally.
    - **Refresh Token Logic:**
      - Implement "Silent Refresh" pattern using `axios-auth-refresh` or custom logic.
      - Queue failed requests -> Refresh Token -> Retry Queue -> Logout if fails.
    - **Response Validation:** Even with Orval, ensure Zod schemas validate the runtime data structure if the backend does not strictly adhere to OpenAPI specs.
    
    ## 7. Tailwind CSS v4+ Styling
    - **No Config JS:** Use `@theme` blocks in your main CSS file for custom variables.
    - **Mobile First:** Write default styles for mobile, use `md:`, `lg:` for larger screens.
    - **Color Palette:** Use OKLCH color space for modern vibrancy.
    - **Sorting:** Sort utility classes logically.
    - **Avoid `@apply`:** Use utility classes directly in JSX.
    
    ## 8. Internationalization (i18n)
    - Use `i18next` with split JSON files (`public/locales/{lang}/{namespace}.json`).
    - Use keys that represent the path: `t('header.navigation.home')`.
    
    ## 9. Theme (Dark/Light Mode)
    - Implement a `ThemeContext`.
    - Use Tailwind's `dark:` variant.
    - Sync `color-scheme` on `<html>`.
    
    ## 10. Testing Strategies
    - **Unit:** `Vitest` for logic/hooks.
    - **Component:** `React Testing Library` for accessibility/interaction.
    - **E2E:** `Playwright` for critical flows (Login, Payment).
    - **Rule:** Critical features must have a spec file.
    
    ## 11. Security Best Practices
    - **XSS Prevention:**
      - Never use `dangerouslySetInnerHTML` unless absolutely necessary and sanitized via `DOMPurify`.
      - Escaping is handled automatically by React, do not bypass it.
    - **Dependencies:** Run `pnpm audit` regularly. Prefer well-maintained libraries.
    - **Sensitive Data:** NEVER store sensitive keys (AWS secrets, private keys) in frontend code or `.env` files exposed to the client.
    - **Tokens:** Prefer `HttpOnly` cookies for tokens if possible. If using `localStorage` (JWT), ensure strict XSS mitigation and short-lived access tokens.
    
    ---
    
    # Folder Structure Template
    Adhere to this structure:
    
    src/
    ├── api/
    │   ├── generated/   # Orval generated files (DO NOT EDIT MANUALLY)
    │   ├── client.ts    # Axios instance & Interceptors
    │   └── model/       # Manual Zod schemas (if not generated)
    ├── components/
    │   ├── ui/          # Generic, reusable UI components
    │   ├── features/    # Domain-specific components
    │   └── layout/      # Layout wrappers
    ├── hooks/           # Custom hooks (non-API)
    ├── lib/             # Utility libraries (Zod, DOMPurify, formatters)
    ├── locales/         # i18n configurations
    ├── routes/          # TanStack Router file routes
    ├── stores/          # React Contexts (Theme, Auth)
    ├── types/           # Global TypeScript types (that are not API models)
    └── main.tsx         # Entry point
    
    # Response Guidelines for AI
    1.  **Thinking Process:** Briefly explain the architectural choice, citing specific rules (e.g., "Using Orval generated hook for type safety...").
    2.  **Code generation:** Include necessary imports. Use Tailwind v4 syntax.
    3.  **Refactoring:** Prioritize removing `useEffect`, adopting `useOptimistic`, and leveraging Orval hooks.
    4.  **Dependencies:** If a new library is needed, suggest installing via `pnpm add`.

    Tags

    reactvitetypescripttailwindcsstanstackorval@tanstack/react-router@tanstack/react-query

    Comments

    More Rules

    View all

    Kechwafflesnew Cursor Rules

    C
    CODEFORYOU69

    AI DRAMA FACTORY Cursor Rules

    R
    Robert0157

    Site Cursor Rules

    R
    RaphaelVitoi

    KindnessBot Cursor Rules

    F
    foodyogi

    Neptunik Cursor Rules

    F
    fjpedrosa

    Cvcraft Cursor Rules

    C
    CedricCT

    Stay up to date

    Get the latest Cursor prompts, rules, and resources delivered to your inbox weekly.

    Neura Market LogoNeura Market

    Discover the best AI prompts, plugins, and resources for Cursor and more.

    Content Types

    • Rules
    • Prompts
    • MCPs
    • Agents
    • Guides

    Platforms

    • ChatGPT Directory
    • Claude Directory
    • Gemini Directory
    • Cursor Directory
    • Grok Directory
    • Perplexity Directory
    • DeepSeek Directory
    • CoPilot Directory
    • Stable Diffusion Directory
    • Midjourney Directory
    • All Directories

    Resources

    • Blog
    • Documentation
    • Help Center
    • Marketplace

    Legal

    • Privacy Policy
    • Terms of Service

    © 2026 Neura Market. All rights reserved.

    |

    Not affiliated with any AI platform vendors.

    Neura Market

    Custom AI Systems & Services

    Our team of experienced AI builders will help build custom AI systems, workflows, and solutions for your business.

    Request custom work

    Ready-made automations for this

    Workflows from the Neura Market marketplace related to this Cursor resource

    • Build AI Agents with Think-Plan-Act Architecture Using Llama-4 Reasoningn8n · $24.99 · Related topic
    • Automated Enterprise Knowledge Retrieval and Response Generationn8n · $14.99 · Related topic
    • Intelligent AI-Powered PostgreSQL Query Assistant with Dual-Agent Architecturen8n · $14.99 · Related topic
    Browse all workflows